XP_005251567.1 has 147 amino acids
Query: DUF2368 [M=134] Accession: PF10166.13 Description: Uncharacterised conserved protein (DUF2368) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-62 192.9 1.6 1e-61 192.7 1.6 1.0 1 XP_005251567.1 Domain annotation for each sequence (and alignments): >> XP_005251567.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 192.7 1.6 1e-61 1e-61 1 134 [] 1 134 [. 1 134 [. 1.00 Alignments for each domain: == domain 1 score: 192.7 bits; conditional E-value: 1e-61 DUF2368 1 mgqlisksmeenlkknqefleelqklqlerqlamqnlmrerqmAlqiaksrellkwlasfyalavvllaagaikrkkpllliPlvPLtfvvgYqy 95 mg+++sksm+e++k+++ef+ ++++lqlerql+mq +mrerqmA+qia+sre+lk++++f++la++ l+agaik+kkp++l+P+vPL+f+++Yqy XP_005251567.1 1 MGFIFSKSMNESMKNQKEFMLMNARLQLERQLIMQSEMRERQMAMQIAWSREFLKYFGTFFGLAAISLTAGAIKKKKPAFLVPIVPLSFILTYQY 95 9********************************************************************************************** PP DUF2368 96 dlaYGdklerireeAerileeesellelPkglptvesie 134 dl YG++ler+++eAe ile+e++ l+lP g++t+esie XP_005251567.1 96 DLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIE 134 *************************************98 PP
Or compare XP_005251567.1 to CDD or PaperBLAST