XP_005255214.1 has 303 amino acids
Query: FAM86 [M=94] Accession: PF14904.10 Description: Family of unknown function Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-24 72.6 3.7 1.5e-18 53.0 0.3 2.3 2 XP_005255214.1 Domain annotation for each sequence (and alignments): >> XP_005255214.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 53.0 0.3 1.5e-18 1.5e-18 2 48 .. 7 53 .. 6 53 .. 0.95 2 ! 24.9 0.4 8.8e-10 8.8e-10 69 93 .. 47 71 .. 47 72 .. 0.92 Alignments for each domain: == domain 1 score: 53.0 bits; conditional E-value: 1.5e-18 FAM86 2 aeaeellkeferrFlamrrlesfPwqaleeeLkeskssellkeilkk 48 a++e ll++ferrFla+r+l+sfPwq+le +L++s++sell++il+k XP_005255214.1 7 AGTELLLQSFERRFLAARTLRSFPWQSLEAKLRDSSDSELLRDILHK 53 568899**************************************985 PP == domain 2 score: 24.9 bits; conditional E-value: 8.8e-10 FAM86 69 LseLikkhEaakvepLdelYealae 93 L ++++khEa+++epLdelYealae XP_005255214.1 47 LRDILHKHEAVHTEPLDELYEALAE 71 567899******************9 PP
Or compare XP_005255214.1 to CDD or PaperBLAST