XP_005269535.1 has 1435 amino acids
Query: DUF4585 [M=73]
Accession: PF15232.10
Description: Domain of unknown function (DUF4585)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3e-32 96.8 5.0 8.5e-32 95.4 5.0 1.8 1 XP_005269535.1
Domain annotation for each sequence (and alignments):
>> XP_005269535.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 95.4 5.0 8.5e-32 8.5e-32 2 73 .] 1270 1340 .. 1269 1340 .. 0.97
Alignments for each domain:
== domain 1 score: 95.4 bits; conditional E-value: 8.5e-32
DUF4585 2 aaatqrklLlDpesGryyvvdlPlqvktktlfDpetGqYVevllpsaesevseaapvelllsplalgPgayp 73
++atq k+L+Dp+sG+y+v+dlPlqvk+kt++DpetG+YV+v++ps+e+ ++e+ p+++l++p++l+Pg+ p
XP_005269535.1 1270 YPATQ-KVLQDPQSGEYFVFDLPLQVKIKTFYDPETGKYVKVSIPSSEGASPEPPPPDALAAPYVLYPGFQP 1340
78999.***************************************************************976 PP
Or compare XP_005269535.1 to CDD or PaperBLAST