XP_005274349.1 has 544 amino acids
Query: DUF4211 [M=137] Accession: PF13926.10 Description: Domain of unknown function (DUF4211) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-39 120.4 1.2 8.9e-39 119.0 1.2 1.8 1 XP_005274349.1 Domain annotation for each sequence (and alignments): >> XP_005274349.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 119.0 1.2 8.9e-39 8.9e-39 1 137 [] 297 449 .. 297 449 .. 0.92 Alignments for each domain: == domain 1 score: 119.0 bits; conditional E-value: 8.9e-39 DUF4211 1 dFivedd......ddelgepe...........elplefsrkskkklkehFkdvvewlvhnaidpdflkslek.....kddelylvalkkldde.v 72 dF+v+d+ + + +l + s +s +++++hF++vv++l++na+d++fl +l++ ++++++l++l++ld++ v XP_005274349.1 297 DFVVQDEegdeenK------NqqgeklttsqlKLVKQNSLYSFSDHYTHFERVVKALLINALDESFLGTLYDgtrqkSYAKDMLTSLHYLDNRfV 385 8******5543320......2235566777899*******************************************9****************** PP DUF4211 73 kgladsllsssaWkpeFkkalearPelevteleaeeksCdACnrskhpatfevrlsGkpYnketl 137 +++++sl+s+s+Wk+++k+++e++++++++ ++e+ sC+AC+++++ ++++v+lsG++Yn++t+ XP_005274349.1 386 QPRLESLVSRSRWKEQYKERVENYSNVSIHLKNPENCSCQACGLHRY-CKYSVHLSGELYNTRTM 449 ***********************************************.**************997 PP
Or compare XP_005274349.1 to CDD or PaperBLAST