PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006232563.1 to PF06840 (PDC10_C)

XP_006232563.1 has 210 amino acids

Query:       PDC10_C  [M=90]
Accession:   PF06840.15
Description: Programmed cell death protein 10, C-terminal
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.9e-44  136.0   1.6    3.7e-44  135.0   1.6    1.5  1  XP_006232563.1  


Domain annotation for each sequence (and alignments):
>> XP_006232563.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  135.0   1.6   3.7e-44   3.7e-44       1      90 []      72     159 ..      72     159 .. 0.98

  Alignments for each domain:
  == domain 1  score: 135.0 bits;  conditional E-value: 3.7e-44
         PDC10_C   1 vnlneslLrlagssdveeyiierkeeefqelnkkaraLkkiLsriPdeindRkkfLetikeiAsaikklLdavnevskkiqekeekkale 90 
                     vn++eslLr+a++ dveey+ier e efq+ln+karaLk+iLs+iPdeindR +fL+tik+iAsaik+lLd+vn+v+kk+q+ ++++ale
  XP_006232563.1  72 VNFTESLLRMAAD-DVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQY-QNRRALE 159
                     8************.********************************************************************.8899997 PP



Or compare XP_006232563.1 to CDD or PaperBLAST