XP_006435325.1 has 637 amino acids
Query: DUF630 [M=59]
Accession: PF04783.16
Description: Protein of unknown function (DUF630)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.9e-30 91.1 0.5 6.8e-30 89.4 0.3 2.1 2 XP_006435325.1
Domain annotation for each sequence (and alignments):
>> XP_006435325.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.4 0.3 6.8e-30 6.8e-30 1 58 [. 1 58 [. 1 58 [. 0.99
2 ? -3.3 0.0 0.58 0.58 46 56 .. 527 537 .. 527 539 .. 0.80
Alignments for each domain:
== domain 1 score: 89.4 bits; conditional E-value: 6.8e-30
DUF630 1 MGcaaSklddeeavalCreRkrllkqaveaRyaLAaaHvaYlqSLrnvgaaLrrFaee 58
MGc++Skld+ +avalCr+R+r+l++a+++ yaLA+aHvaY+qSL+++g +L++F+++
XP_006435325.1 1 MGCSTSKLDNLPAVALCRDRCRFLEEALRHSYALADAHVAYMQSLKTLGPTLHQFFDH 58
*******************************************************985 PP
== domain 2 score: -3.3 bits; conditional E-value: 0.58
DUF630 46 rnvgaaLrrFa 56
++v++aL+ F
XP_006435325.1 527 KEVAEALQSFC 537
57999999997 PP
Or compare XP_006435325.1 to CDD or PaperBLAST