XP_006538287.1 has 1132 amino acids
Query: UBAP2-Lig [M=33]
Accession: PF12478.12
Description: UBAP2/protein lingerer
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.2e-21 61.1 5.2 3.1e-20 58.3 0.8 2.8 2 XP_006538287.1
Domain annotation for each sequence (and alignments):
>> XP_006538287.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 58.3 0.8 3.1e-20 3.1e-20 1 33 [] 512 544 .. 512 544 .. 0.99
2 ! 3.9 0.3 0.0033 0.0033 6 21 .. 766 782 .. 763 784 .. 0.89
Alignments for each domain:
== domain 1 score: 58.3 bits; conditional E-value: 3.1e-20
UBAP2-Lig 1 PpSkIPasAVEMPgdanissLDVQFGaldFGse 33
P+Sk+P sAVEMPg++++ +L+VQFGal+FGse
XP_006538287.1 512 PASKVPVSAVEMPGSSDVTGLNVQFGALEFGSE 544
9*******************************8 PP
== domain 2 score: 3.9 bits; conditional E-value: 0.0033
UBAP2-Lig 6 PasAVEMPgda.nissL 21
P+s V++Pg+ +ssL
XP_006538287.1 766 PSSGVVLPGSMsTVSSL 782
9*********9888887 PP
Or compare XP_006538287.1 to CDD or PaperBLAST