XP_006612221.1 has 145 amino acids
Query: DM9 [M=115] Accession: PF11901.12 Description: DM9 repeat Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-52 161.2 0.8 1.5e-50 156.2 0.2 2.3 2 XP_006612221.1 Domain annotation for each sequence (and alignments): >> XP_006612221.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.0 0.0 0.0012 0.0012 55 77 .. 4 27 .. 2 28 .. 0.78 2 ! 156.2 0.2 1.5e-50 1.5e-50 1 114 [. 25 135 .. 25 136 .. 0.98 Alignments for each domain: == domain 1 score: 5.0 bits; conditional E-value: 0.0012 DM9 55 yeWvpssdgs.vpkgAvegGtted 77 y+W + s g+ +p+ Av gG++ d XP_006612221.1 4 YRWLNRSAGQsLPETAVLGGRDID 27 899988887627788*****9876 PP == domain 2 score: 156.2 bits; conditional E-value: 1.5e-50 DM9 1 dsdgspiYvgRakhegdllpgkvvpekgaayvsyggkehekseyevLvakepseyeWvpssdgsvpkgAvegGttedgeplyigrakyegsltiG 95 d dgs+iYvgRa+hegd+lp+kv+p+k++ayv+y+g+eh k+++evL++ e+ W+ +s+g vp++Av++G+t++geply+gr+ ++gs+t+G XP_006612221.1 25 DIDGSTIYVGRAFHEGDMLPAKVIPDKNVAYVCYNGEEHCKHNFEVLCQ---GEFAWEFCSNGAVPSDAVVAGQTSSGEPLYVGRVLHNGSQTVG 116 679*********************************************5...89***************************************** PP DM9 96 kvhpshkvlyipyggkevs 114 kv+ sh++lyip++g+e+s XP_006612221.1 117 KVQASHGCLYIPFDGEELS 135 *****************97 PP
Or compare XP_006612221.1 to CDD or PaperBLAST