PaperBLAST – Find papers about a protein or its homologs

 

Align XP_010095892.1 to PF13664 (DUF4149)

XP_010095892.1 has 486 amino acids

Query:       DUF4149  [M=102]
Accession:   PF13664.10
Description: Domain of unknown function (DUF4149)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-26   78.3   5.9    2.3e-26   78.3   5.9    2.2  3  XP_010095892.1  


Domain annotation for each sequence (and alignments):
>> XP_010095892.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.4   0.0      0.34      0.34      43      59 ..       4      20 ..       2      29 .. 0.58
   2 !   78.3   5.9   2.3e-26   2.3e-26       2     101 ..     303     404 ..     302     405 .. 0.92
   3 ?   -2.0   0.1      0.25      0.25      63      92 ..     452     481 ..     442     484 .. 0.73

  Alignments for each domain:
  == domain 1  score: -2.4 bits;  conditional E-value: 0.34
         DUF4149 43 llglalavlllltellr 59
                    +++l l+v +l+t+ + 
  XP_010095892.1  4 VVSLCLVVTSLVTAGVL 20
                    45555666666665544 PP

  == domain 2  score: 78.3 bits;  conditional E-value: 2.3e-26
         DUF4149   2 llalllGsllfvtfvvapvlfkaLpraqfgalqsklFpvyfl...lglalavlllltellrgsellaaaekaqllllavmllltllnafvlePri 93 
                     ++++++G++++ tf+ ++vl  aLpr+qfg +qsk++pvyf+   +g+++avl ll++ + + + ++ aek+q+  l+++l+l+++n+++lePr+
  XP_010095892.1 303 TFSTAYGTAVWETFILSYVLAGALPRQQFGVVQSKIYPVYFRtmaWGIGTAVLGLLVTGRGK-AFSSMAEKFQIFNLLASLVLVFVNMLYLEPRA 396
                     699**************************************977778888888888777765.8888999************************* PP

         DUF4149  94 talkeerk 101
                     t++++er 
  XP_010095892.1 397 TKVMFERM 404
                     *****996 PP

  == domain 3  score: -2.0 bits;  conditional E-value: 0.25
         DUF4149  63 llaaaekaqllllavmllltllnafvlePr 92 
                     +l + + ++  l +++l++  ++ ++l+ r
  XP_010095892.1 452 RLKKLNTWSSFLNILSLMSLSWHVYYLGQR 481
                     566777788888888888888888888776 PP



Or compare XP_010095892.1 to CDD or PaperBLAST