XP_010324172.1 has 243 amino acids
Query: RTE1 [M=149] Accession: PF05608.18 Description: RTE1-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-64 202.9 0.3 2.3e-64 202.2 0.3 1.4 1 XP_010324172.1 Domain annotation for each sequence (and alignments): >> XP_010324172.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 202.2 0.3 2.3e-64 2.3e-64 1 149 [] 37 185 .. 37 185 .. 0.99 Alignments for each domain: == domain 1 score: 202.2 bits; conditional E-value: 2.3e-64 RTE1 1 dpkrerfPccivwtplPvvswllPfiGHvGicredGvildFagpnfvsvdnlafgavarylqldkekvslasnlseakseeeekeeesetaitwd 95 dp++++fPcc+vwtplPv+swl+Pf+GHvGicredG+i+dF+g +++ ++l +g+va+y+q+d++++++a+n +++++ +++ +ta++wd XP_010324172.1 37 DPSTQKFPCCLVWTPLPVISWLAPFVGHVGICREDGTIVDFSGDSMIHFGQLFYGTVAKYYQVDRQQCCFARNFGGHTCRKGYEHVVFGTAVSWD 131 7999******************************************************************************************* PP RTE1 96 dalekateefqhrsynlftcnchsfvanalnrlkykgskkwnvvnlallillkg 149 da++ +++f++r++++f cn hsf a++ln l+++gs++wn++n+ +li+++g XP_010324172.1 132 DAVQLFRRTFENRNFKVFSCNGHSFAADCLNLLSFRGSMRWNMINVGALIMFEG 185 ***************************************************987 PP
Or compare XP_010324172.1 to CDD or PaperBLAST