PaperBLAST – Find papers about a protein or its homologs

 

Align XP_010756710.1 to PF10233 (Cg6151-P)

XP_010756710.1 has 147 amino acids

Query:       Cg6151-P  [M=113]
Accession:   PF10233.13
Description: Uncharacterized conserved protein CG6151-P
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-46  143.5  15.4      2e-46  143.2  15.4    1.1  1  XP_010756710.1  


Domain annotation for each sequence (and alignments):
>> XP_010756710.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  143.2  15.4     2e-46     2e-46       1     113 []      19     129 ..      19     129 .. 0.97

  Alignments for each domain:
  == domain 1  score: 143.2 bits;  conditional E-value: 2e-46
        Cg6151-P   1 lGilsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaa 95 
                     +G+l+i+lc+alGianif+++v  i+fsi++l+s+f+++f+EvPlllricpts+kfd+f+++f+tn+mra++Yl+++++qwls+iv+atsli+aa
  XP_010756710.1  19 TGVLCILLCFALGIANIFHIRV--IAFSIVCLASSFLLIFVEVPLLLRICPTSSKFDAFVRRFTTNYMRALMYLILSIIQWLSIIVSATSLIAAA 111
                     69****************9954..6********************************************************************** PP

        Cg6151-P  96 vlllitavlYglaalkkq 113
                     ++ll+++v+Y+la+l++q
  XP_010756710.1 112 FFLLLAGVFYLLAGLTNQ 129
                     ***************987 PP



Or compare XP_010756710.1 to CDD or PaperBLAST