XP_011490829.2 has 1371 amino acids
Query: DUF4585 [M=73]
Accession: PF15232.10
Description: Domain of unknown function (DUF4585)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-34 104.6 4.6 3.5e-34 103.0 4.6 1.9 1 XP_011490829.2
Domain annotation for each sequence (and alignments):
>> XP_011490829.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 103.0 4.6 3.5e-34 3.5e-34 2 73 .] 1183 1252 .. 1182 1252 .. 0.97
Alignments for each domain:
== domain 1 score: 103.0 bits; conditional E-value: 3.5e-34
DUF4585 2 aaatqrklLlDpesGryyvvdlPlqvktktlfDpetGqYVevllpsaesevseaapvelllsplalgPgayp 73
a++tqrk+LlDp++G+yy+vd+Plqv+tk+lfDp+tGqYVev++p+ s v++++pv+l+lsplal+P+ay+
XP_011490829.2 1183 APQTQRKMLLDPTTGHYYLVDTPLQVTTKKLFDPDTGQYVEVPMPH--SPVAPVTPVHLSLSPLALSPPAYT 1252
79*******************************************7..9********************996 PP
Or compare XP_011490829.2 to CDD or PaperBLAST