XP_011671877.2 has 181 amino acids
Query: Cg6151-P [M=113]
Accession: PF10233.13
Description: Uncharacterized conserved protein CG6151-P
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-29 88.4 8.9 2.6e-29 88.1 8.9 1.1 1 XP_011671877.2
Domain annotation for each sequence (and alignments):
>> XP_011671877.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 88.1 8.9 2.6e-29 2.6e-29 4 113 .] 41 147 .. 38 147 .. 0.96
Alignments for each domain:
== domain 1 score: 88.1 bits; conditional E-value: 2.6e-29
Cg6151-P 4 lsiilcialGianiftlsvvlivfsilalvsgfvvlfiEvPlllricptsekfdefiekfetnwmraalYlvmavvqwlslivqatslivaavll 98
++++l+i+lG+++++t++ ++iv++i+ ++ gf+ +++E+P++++++++++k++++ e++ w++a++Yl++ +v++++++ ++s i+a++ +
XP_011671877.2 41 VAGVLAIILGLISLITVKGMCIVAGIYIILLGFLTILLEAPFCCQFLDITDKVSKWSERR-APWQKALFYLLLPIVPFFFCT--GLSSIFACLGI 132
7899********************************************************.9***************66666..*********** PP
Cg6151-P 99 litavlYglaalkkq 113
++t+vlYgl+ ++k+
XP_011671877.2 133 MATGVLYGLVFIGKK 147
************997 PP
Or compare XP_011671877.2 to CDD or PaperBLAST