XP_012047299.1 has 513 amino acids
Query: DUF2838 [M=111]
Accession: PF10998.12
Description: Protein of unknown function (DUF2838)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
4.7e-49 151.6 10.6 4.7e-49 151.6 10.6 1.9 2 XP_012047299.1
Domain annotation for each sequence (and alignments):
>> XP_012047299.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 151.6 10.6 4.7e-49 4.7e-49 1 111 [] 146 256 .. 146 256 .. 1.00
2 ? -2.7 0.1 0.38 0.38 87 97 .. 360 370 .. 355 396 .. 0.52
Alignments for each domain:
== domain 1 score: 151.6 bits; conditional E-value: 4.7e-49
DUF2838 1 dklsFvlgvlnvlltalllgkapellplvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGplalAii 95
dk+sF++gvl +++t+ll+g+ape++p+ ytv++++++p+r++ty++k++hYfl+DlCYfvn+l ll+++v+p+s+ lf++++ l+ Gpla Aii
XP_012047299.1 146 DKVSFLFGVLALAFTCLLYGMAPEWFPVAYTVQAAFYMPIRIYTYHRKAWHYFLFDLCYFVNALDLLWIWVFPSSTFLFICCYLLTLGPLASAII 240
8********************************************************************************************** PP
DUF2838 96 twrnslvfhsldkvtS 111
twrnslvfhsldkvtS
XP_012047299.1 241 TWRNSLVFHSLDKVTS 256
***************8 PP
== domain 2 score: -2.7 bits; conditional E-value: 0.38
DUF2838 87 nGplalAiitw 97
+G+l +ii++
XP_012047299.1 360 FGQLIYSIIFM 370
45555554432 PP
Or compare XP_012047299.1 to CDD or PaperBLAST