PaperBLAST – Find papers about a protein or its homologs

 

Align XP_012047299.1 to PF10998 (DUF2838)

XP_012047299.1 has 513 amino acids

Query:       DUF2838  [M=111]
Accession:   PF10998.13
Description: Protein of unknown function (DUF2838)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.9e-49  151.2  10.6    5.9e-49  151.2  10.6    1.9  2  XP_012047299.1  


Domain annotation for each sequence (and alignments):
>> XP_012047299.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.2  10.6   5.9e-49   5.9e-49       1     111 []     146     256 ..     146     256 .. 1.00
   2 ?   -2.7   0.1      0.38      0.38      87      97 ..     360     370 ..     355     396 .. 0.52

  Alignments for each domain:
  == domain 1  score: 151.2 bits;  conditional E-value: 5.9e-49
         DUF2838   1 dklsFvlgvlnvlltafllgkapellhlvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGplalAii 95 
                     dk+sF++gvl +++t++l+g+ape++++ ytv++++++p+r++ty++k++hYfl+DlCYfvn+l ll+++v+p+s+ lf++++ l+ Gpla Aii
  XP_012047299.1 146 DKVSFLFGVLALAFTCLLYGMAPEWFPVAYTVQAAFYMPIRIYTYHRKAWHYFLFDLCYFVNALDLLWIWVFPSSTFLFICCYLLTLGPLASAII 240
                     8********************************************************************************************** PP

         DUF2838  96 twrnslvfhsldkvtS 111
                     twrnslvfhsldkvtS
  XP_012047299.1 241 TWRNSLVFHSLDKVTS 256
                     ***************8 PP

  == domain 2  score: -2.7 bits;  conditional E-value: 0.38
         DUF2838  87 nGplalAiitw 97 
                     +G+l  +ii++
  XP_012047299.1 360 FGQLIYSIIFM 370
                     45555554433 PP



Or compare XP_012047299.1 to CDD or PaperBLAST