XP_012573034.1 has 115 amino acids
Query: DUF761 [M=36]
Accession: PF05553.16
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.1e-21 60.1 2.4 1.1e-20 59.3 2.4 1.4 1 XP_012573034.1
Domain annotation for each sequence (and alignments):
>> XP_012573034.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.3 2.4 1.1e-20 1.1e-20 2 36 .] 79 113 .. 78 113 .. 0.98
Alignments for each domain:
== domain 1 score: 59.3 bits; conditional E-value: 1.1e-20
DUF761 2 eevDakAEaFIakFreqlrLQRqeSikryqemlaR 36
e+++a A+aFI++Fr+ql LQR++Si++y mlaR
XP_012573034.1 79 EDINASADAFIKNFRQQLLLQRLQSIENYEKMLAR 113
89********************************8 PP
Or compare XP_012573034.1 to CDD or PaperBLAST