PaperBLAST – Find papers about a protein or its homologs

 

Align XP_014957540.2 to PF16297 (DUF4939)

XP_014957540.2 has 1333 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    8.5e-19   53.8   0.0    1.9e-18   52.7   0.0    1.5  1  XP_014957540.2  


Domain annotation for each sequence (and alignments):
>> XP_014957540.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   52.7   0.0   1.9e-18   1.9e-18      21     105 ..     183     267 ..     168     271 .. 0.92

  Alignments for each domain:
  == domain 1  score: 52.7 bits;  conditional E-value: 1.9e-18
         DUF4939  21 wrnpipfpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefGw 105
                      +  +p p++f+G+     efiv     +    + f++d+l+v ++i++l+G a+ew+   ++k+s +++++ afl+ m ++f +
  XP_014957540.2 183 NKGQLPTPKQFSGDRREYHEFIVLCQLILQSYPRVFCNDRLRVGYVISHLSGMAMEWASDLVEKESSMIDDFPAFLEAMNDTFEY 267
                     56679*******************999999999************************************************9977 PP



Or compare XP_014957540.2 to CDD or PaperBLAST