XP_015611637.1 has 222 amino acids
Query: SAYSvFN [M=70]
Accession: PF10260.14
Description: Uncharacterized conserved domain (SAYSvFN)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
8.8e-29 85.5 0.0 1.3e-28 85.0 0.0 1.2 1 XP_015611637.1
Domain annotation for each sequence (and alignments):
>> XP_015611637.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 85.0 0.0 1.3e-28 1.3e-28 2 70 .] 151 217 .. 150 217 .. 0.98
Alignments for each domain:
== domain 1 score: 85.0 bits; conditional E-value: 1.3e-28
SAYSvFN 2 lllWlllqliaielefgavfvilsllvliylnlrtgkrkegelSAYSvFNkgcerieGtldaeqlerel 70
+++W+l++ ia +++g++f++ +++++i++nl g+r++g++SAYS+FN+++++++Gtl+ae+++r++
XP_015611637.1 151 IAMWFLFAPIAQMYDVGPLFILGTGFLVILCNL--GRRQQGDVSAYSIFNEDFRELPGTLNAERIDRDI 217
789******************************..********************************97 PP
Or compare XP_015611637.1 to CDD or PaperBLAST