XP_015621003.1 has 241 amino acids
Query: RTE1 [M=149] Accession: PF05608.18 Description: RTE1-like Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.5e-73 231.3 0.2 3.3e-73 230.9 0.2 1.2 1 XP_015621003.1 Domain annotation for each sequence (and alignments): >> XP_015621003.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 230.9 0.2 3.3e-73 3.3e-73 1 149 [] 36 184 .. 36 184 .. 0.99 Alignments for each domain: == domain 1 score: 230.9 bits; conditional E-value: 3.3e-73 RTE1 1 dpkrerfPccivwtplPvvswllPfiGHvGicredGvildFagpnfvsvdnlafgavarylqldkekvslasnlseakseeeekeeesetaitwd 95 dpkr+rfPccivwtplP+vswl+P+iGH GicredG++ldFag+n+vs+dn+a+g++arylqld++k++++ nl+++ +e+++k++e++tai+wd XP_015621003.1 36 DPKRARFPCCIVWTPLPIVSWLAPYIGHAGICREDGTVLDFAGSNLVSMDNFAYGSIARYLQLDRKKCCFPVNLATHVCERSYKHAEAGTAISWD 130 89********************************************************************************************* PP RTE1 96 dalekateefqhrsynlftcnchsfvanalnrlkykgskkwnvvnlallillkg 149 dal+ +++f h+ ynlftcnc+sfvan+lnrl+y+gs kwnv+n+a+l++l+g XP_015621003.1 131 DALQLGMRSFGHKFYNLFTCNCYSFVANCLNRLAYNGSVKWNVLNVAALVWLRG 184 **************************************************9987 PP
Or compare XP_015621003.1 to CDD or PaperBLAST