XP_015649063.1 has 77 amino acids
Query: DUF4535 [M=45]
Accession: PF15054.10
Description: Domain of unknown function (DUF4535)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
9.2e-25 72.4 0.1 1.4e-24 71.9 0.1 1.3 1 XP_015649063.1
Domain annotation for each sequence (and alignments):
>> XP_015649063.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 71.9 0.1 1.4e-24 1.4e-24 2 45 .] 8 51 .. 7 51 .. 0.97
Alignments for each domain:
== domain 1 score: 71.9 bits; conditional E-value: 1.4e-24
DUF4535 2 lfsFglGtycGiYvAQNYeVPnvkklantglekakeleekyrKp 45
lf F++Gt++G+Y AQNY+VPn++ la++g++ ak++ee+yrK+
XP_015649063.1 8 LFPFLVGTAVGVYAAQNYKVPNLRGLADRGVDAAKQYEEAYRKK 51
8******************************************6 PP
Or compare XP_015649063.1 to CDD or PaperBLAST