XP_016863465.1 has 170 amino acids
Query: DUF4464 [M=230]
Accession: PF14713.10
Description: Domain of unknown function (DUF4464)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.8e-34 104.7 0.7 4e-34 104.2 0.7 1.2 1 XP_016863465.1
Domain annotation for each sequence (and alignments):
>> XP_016863465.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 104.2 0.7 4e-34 4e-34 2 101 .. 31 129 .. 30 130 .. 0.97
Alignments for each domain:
== domain 1 score: 104.2 bits; conditional E-value: 4e-34
DUF4464 2 sllefetYedYLdsfitkedlrYLedeelarqlvelgyrgtgevlsreeFearkkaleealkpkkkkqkklfsaglelskdpllkaLaeREeanr 96
+++f++Yed+Lds+it+ dl+YLede+larqlvelgyrgtge ++re+Feark+a+e a+ +++ +qk+l+sag+ +d++l+aLa REe nr
XP_016863465.1 31 IVTQFNAYEDFLDSQITTVDLYYLEDETLARQLVELGYRGTGERVKREDFEARKAAIEIARLAERAQQKTLTSAGK-DLQDNFLTALAMREEDNR 124
589*************************************************************999*********.55**************** PP
DUF4464 97 skkls 101
s+kls
XP_016863465.1 125 SGKLS 129
***97 PP
Or compare XP_016863465.1 to CDD or PaperBLAST