PaperBLAST – Find papers about a protein or its homologs

 

Align XP_018638188.1 to PF13863 (DUF4200)

XP_018638188.1 has 202 amino acids

Query:       DUF4200  [M=119]
Accession:   PF13863.11
Description: Domain of unknown function (DUF4200)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.5e-22   66.4  18.6    2.3e-22   65.8  18.6    1.3  1  XP_018638188.1  


Domain annotation for each sequence (and alignments):
>> XP_018638188.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   65.8  18.6   2.3e-22   2.3e-22       3     106 ..      57     160 ..      55     162 .. 0.97

  Alignments for each domain:
  == domain 1  score: 65.8 bits;  conditional E-value: 2.3e-22
         DUF4200   3 ekkremflvqealdakkeeierleellkereeelekkeqelkedlvkfdkflkeneakreraekkaeeetkekkekekeikklkaeleelkseis 97 
                     e + +m +v++al++ ke +++ e++++ +e++l++k ++l+ +l++f+kf+  ne+kr+raek+a  e++  +ekek i  lk  +e+++++ +
  XP_018638188.1  57 ESRGQMHEVDQALARHKEYYANEEKQFRVKEAQLKEKGAQLQLQLNRFNKFVDTNEDKRRRAEKRAVAEREIIREKEKTIVTLKVAVEQMEAKEQ 151
                     7789******************************************************************************************* PP

         DUF4200  98 kleekleey 106
                     kle+ ++++
  XP_018638188.1 152 KLEAGVKRC 160
                     ****99987 PP



Or compare XP_018638188.1 to CDD or PaperBLAST