PaperBLAST – Find papers about a protein or its homologs

 

Align XP_018654710.1 to PF13863 (DUF4200)

XP_018654710.1 has 550 amino acids

Query:       DUF4200  [M=119]
Accession:   PF13863.11
Description: Domain of unknown function (DUF4200)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-28   86.3  13.0      1e-28   86.3  13.0    2.4  2  XP_018654710.1  


Domain annotation for each sequence (and alignments):
>> XP_018654710.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   86.3  13.0     1e-28     1e-28       1     119 []     259     377 ..     259     377 .. 0.99
   2 ?   -1.4   0.3      0.16      0.16      24      44 ..     381     401 ..     378     420 .. 0.58

  Alignments for each domain:
  == domain 1  score: 86.3 bits;  conditional E-value: 1e-28
         DUF4200   1 llekkremflvqealdakkeeierleellkereeelekkeqelkedlvkfdkflkeneakreraekkaeeetkekkekekeikklkaeleelkse 95 
                     +++++remf +++ ++ +++e +rleel++ ++++le +e  l++d++ fd+flken++ +++a  + e+e++++  +  +ik+l+ + +++++e
  XP_018654710.1 259 FIANRREMFFLEYLIAVQRSELKRLEELASHEDRKLELAEHCLEQDAALFDEFLKENDKSSVEAVANSEQEARKRAMMVDKIKQLTIHKSQINAE 353
                     799******************************************************************************************** PP

         DUF4200  96 iskleekleeykkYekfLekvvpk 119
                     i+kl+e++++yk +e fLe++vp+
  XP_018654710.1 354 ITKLKETVKDYKYFEAFLERLVPE 377
                     *********************985 PP

  == domain 2  score: -1.4 bits;  conditional E-value: 0.16
         DUF4200  24 rleellkereeelekkeqelk 44 
                      ++++++e +++l+ k++   
  XP_018654710.1 381 SQRKAVREDKRQLKYKQKLQL 401
                     455556666666665555444 PP



Or compare XP_018654710.1 to CDD or PaperBLAST