XP_018654710.1 has 550 amino acids
Query: DUF4200 [M=119] Accession: PF13863.11 Description: Domain of unknown function (DUF4200) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-28 86.3 13.0 1e-28 86.3 13.0 2.4 2 XP_018654710.1 Domain annotation for each sequence (and alignments): >> XP_018654710.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 86.3 13.0 1e-28 1e-28 1 119 [] 259 377 .. 259 377 .. 0.99 2 ? -1.4 0.3 0.16 0.16 24 44 .. 381 401 .. 378 420 .. 0.58 Alignments for each domain: == domain 1 score: 86.3 bits; conditional E-value: 1e-28 DUF4200 1 llekkremflvqealdakkeeierleellkereeelekkeqelkedlvkfdkflkeneakreraekkaeeetkekkekekeikklkaeleelkse 95 +++++remf +++ ++ +++e +rleel++ ++++le +e l++d++ fd+flken++ +++a + e+e++++ + +ik+l+ + +++++e XP_018654710.1 259 FIANRREMFFLEYLIAVQRSELKRLEELASHEDRKLELAEHCLEQDAALFDEFLKENDKSSVEAVANSEQEARKRAMMVDKIKQLTIHKSQINAE 353 799******************************************************************************************** PP DUF4200 96 iskleekleeykkYekfLekvvpk 119 i+kl+e++++yk +e fLe++vp+ XP_018654710.1 354 ITKLKETVKDYKYFEAFLERLVPE 377 *********************985 PP == domain 2 score: -1.4 bits; conditional E-value: 0.16 DUF4200 24 rleellkereeelekkeqelk 44 ++++++e +++l+ k++ XP_018654710.1 381 SQRKAVREDKRQLKYKQKLQL 401 455556666666665555444 PP
Or compare XP_018654710.1 to CDD or PaperBLAST