XP_021330430.1 has 5209 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.5e-27 79.1 6.5 1.8e-26 77.9 2.8 3.1 3 XP_021330430.1
Domain annotation for each sequence (and alignments):
>> XP_021330430.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -1.9 0.1 0.14 0.14 34 51 .. 18 35 .. 15 37 .. 0.83
2 ? 0.4 0.0 0.028 0.028 6 22 .. 2118 2134 .. 2115 2135 .. 0.87
3 ! 77.9 2.8 1.8e-26 1.8e-26 2 53 .. 4495 4546 .. 4494 4547 .. 0.95
Alignments for each domain:
== domain 1 score: -1.9 bits; conditional E-value: 0.14
ZnF_RZ-type 34 CpeCgatIGGeshnlaag 51
C eCg + +s++ ++g
XP_021330430.1 18 CSECGHKLQSQSYETTQG 35
999999998888888776 PP
== domain 2 score: 0.4 bits; conditional E-value: 0.028
ZnF_RZ-type 6 kgtghwYkCpnGHpYvi 22
++g ++k n H Yvi
XP_021330430.1 2118 DSKGNMWKSSNKHLYVI 2134
56899***********9 PP
== domain 3 score: 77.9 bits; conditional E-value: 1.8e-26
ZnF_RZ-type 2 akafkgtghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagnt 53
a++++g+ +wY CpnGHp+++geCG++me+srCp+C a+IGG++h+++ g++
XP_021330430.1 4495 AQQAMGHLQWYFCPNGHPCTVGECGQPMEVSRCPDCDAEIGGSNHRPVDGFR 4546
6889999*****************************************9986 PP
Or compare XP_021330430.1 to CDD or PaperBLAST