XP_021712290.1 has 64 amino acids
Query: DUF4516 [M=46]
Accession: PF14990.11
Description: Domain of unknown function (DUF4516)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.9e-23 66.2 0.1 9.6e-23 66.0 0.1 1.1 1 XP_021712290.1
Domain annotation for each sequence (and alignments):
>> XP_021712290.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 66.0 0.1 9.6e-23 9.6e-23 1 45 [. 1 45 [. 1 46 [. 0.98
Alignments for each domain:
== domain 1 score: 66.0 bits; conditional E-value: 9.6e-23
DUF4516 1 mPaGvswgqYlklvsasvlSMlaGAqvVHnyYKPdltipdiekke 45
mPaGv+ +Y+k+++a++ SM+aG+q+VH+yY P+ ++ +++ke
XP_021712290.1 1 MPAGVPTKEYVKFMAAALFSMFAGSQIVHLYYNPLKDLNYYIEKE 45
9*****************************************997 PP
Or compare XP_021712290.1 to CDD or PaperBLAST