PaperBLAST – Find papers about a protein or its homologs

 

Align XP_024836565.2 to PF15061 (DUF4538)

XP_024836565.2 has 67 amino acids

Query:       DUF4538  [M=57]
Accession:   PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.5e-27   80.7   0.0    2.8e-27   80.6   0.0    1.0  1  XP_024836565.2  


Domain annotation for each sequence (and alignments):
>> XP_024836565.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   80.6   0.0   2.8e-27   2.8e-27       1      57 []       2      58 ..       2      58 .. 0.97

  Alignments for each domain:
  == domain 1  score: 80.6 bits;  conditional E-value: 2.8e-27
         DUF4538  1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
                    +r+l++al++gGf++lig+A+YPI++ P+++ e+ kk+Q+inra i qe++qP+ +k
  XP_024836565.2  2 SRSLRTALIFGGFISLIGAAFYPIYFWPLMRLEKCKKEQAINRAVIVQEDVQPPRLK 58
                    699**************************************************9876 PP



Or compare XP_024836565.2 to CDD or PaperBLAST