XP_024836565.2 has 67 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.5e-27 80.7 0.0 2.8e-27 80.6 0.0 1.0 1 XP_024836565.2
Domain annotation for each sequence (and alignments):
>> XP_024836565.2
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 80.6 0.0 2.8e-27 2.8e-27 1 57 [] 2 58 .. 2 58 .. 0.97
Alignments for each domain:
== domain 1 score: 80.6 bits; conditional E-value: 2.8e-27
DUF4538 1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPggmk 57
+r+l++al++gGf++lig+A+YPI++ P+++ e+ kk+Q+inra i qe++qP+ +k
XP_024836565.2 2 SRSLRTALIFGGFISLIGAAFYPIYFWPLMRLEKCKKEQAINRAVIVQEDVQPPRLK 58
699**************************************************9876 PP
Or compare XP_024836565.2 to CDD or PaperBLAST