PaperBLAST – Find papers about a protein or its homologs

 

Align XP_026295826.1 to PF11901 (DM9)

XP_026295826.1 has 145 amino acids

Query:       DM9  [M=115]
Accession:   PF11901.12
Description: DM9 repeat
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.3e-51  159.6   0.3    5.9e-50  154.3   0.1    2.3  2  XP_026295826.1  


Domain annotation for each sequence (and alignments):
>> XP_026295826.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    5.1   0.0    0.0011    0.0011      54      77 ..       3      27 ..       1      28 [. 0.79
   2 !  154.3   0.1   5.9e-50   5.9e-50       1     114 [.      25     135 ..      25     136 .. 0.98

  Alignments for each domain:
  == domain 1  score: 5.1 bits;  conditional E-value: 0.0011
             DM9 54 eyeWvpssdgs.vpkgAvegGtted 77
                     y+W + s g+ +pk A++gG++ d
  XP_026295826.1  3 VYRWLNRSAGQdLPKTAIVGGRDID 27
                    6899988877538999*****9876 PP

  == domain 2  score: 154.3 bits;  conditional E-value: 5.9e-50
             DM9   1 dsdgspiYvgRakhegdllpgkvvpekgaayvsyggkehekseyevLvakepseyeWvpssdgsvpkgAvegGttedgeplyigrakyegsltiG 95 
                     d dgs+iYvgRa+hegd+lp+k++p+k+aay++y+g+eh k+++evL++    e+ W+ +s+g vp++Av++G+t++geply+gr+ ++gs+t+G
  XP_026295826.1  25 DIDGSTIYVGRAFHEGDMLPAKIIPDKNAAYICYNGEEHCKDNFEVLCQ---GEFAWEFCSNGAVPSDAVVAGQTSSGEPLYVGRVLHNGSQTVG 116
                     679*********************************************5...89***************************************** PP

             DM9  96 kvhpshkvlyipyggkevs 114
                     kv+ sh++lyip++g+e+s
  XP_026295826.1 117 KVQASHECLYIPFDGEELS 135
                     *****************97 PP



Or compare XP_026295826.1 to CDD or PaperBLAST