XP_026295826.1 has 145 amino acids
Query: DM9 [M=115] Accession: PF11901.12 Description: DM9 repeat Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-51 159.6 0.3 5.9e-50 154.3 0.1 2.3 2 XP_026295826.1 Domain annotation for each sequence (and alignments): >> XP_026295826.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.1 0.0 0.0011 0.0011 54 77 .. 3 27 .. 1 28 [. 0.79 2 ! 154.3 0.1 5.9e-50 5.9e-50 1 114 [. 25 135 .. 25 136 .. 0.98 Alignments for each domain: == domain 1 score: 5.1 bits; conditional E-value: 0.0011 DM9 54 eyeWvpssdgs.vpkgAvegGtted 77 y+W + s g+ +pk A++gG++ d XP_026295826.1 3 VYRWLNRSAGQdLPKTAIVGGRDID 27 6899988877538999*****9876 PP == domain 2 score: 154.3 bits; conditional E-value: 5.9e-50 DM9 1 dsdgspiYvgRakhegdllpgkvvpekgaayvsyggkehekseyevLvakepseyeWvpssdgsvpkgAvegGttedgeplyigrakyegsltiG 95 d dgs+iYvgRa+hegd+lp+k++p+k+aay++y+g+eh k+++evL++ e+ W+ +s+g vp++Av++G+t++geply+gr+ ++gs+t+G XP_026295826.1 25 DIDGSTIYVGRAFHEGDMLPAKIIPDKNAAYICYNGEEHCKDNFEVLCQ---GEFAWEFCSNGAVPSDAVVAGQTSSGEPLYVGRVLHNGSQTVG 116 679*********************************************5...89***************************************** PP DM9 96 kvhpshkvlyipyggkevs 114 kv+ sh++lyip++g+e+s XP_026295826.1 117 KVQASHECLYIPFDGEELS 135 *****************97 PP
Or compare XP_026295826.1 to CDD or PaperBLAST