XP_026693459.1 has 800 amino acids
Query: DUF3399 [M=76] Accession: PF11879.13 Description: Domain of unknown function (DUF3399) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-10 26.7 12.0 3.1e-10 26.7 12.0 3.0 3 XP_026693459.1 Domain annotation for each sequence (and alignments): >> XP_026693459.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.7 12.0 3.1e-10 3.1e-10 3 55 .. 477 528 .. 475 569 .. 0.78 2 ? -1.7 2.7 0.23 0.23 38 59 .. 557 578 .. 547 580 .. 0.71 3 ? -3.6 2.0 0.88 0.88 43 58 .. 674 689 .. 662 695 .. 0.68 Alignments for each domain: == domain 1 score: 26.7 bits; conditional E-value: 3.1e-10 DUF3399 3 sllEsQHHHLLhCLEKTTnheFvdEqtyeenclevslqkrpsrspslssqegl 55 ++E+ H HLLhCLE+TT+he ++ q+ + +++ +s sl s +++ XP_026693459.1 477 ATFEKNHFHLLHCLERTTDHEITENQMCNS-TSVIAIRGGDNESESLISTHSA 528 58*************************984.4555666666677776665443 PP == domain 2 score: -1.7 bits; conditional E-value: 0.23 DUF3399 38 slqkrpsrspslssqegltssC 59 + +srs+s+s + ++C XP_026693459.1 557 RHNDVSSRSSSVSHTSQHDNAC 578 4556788999999877766666 PP == domain 3 score: -3.6 bits; conditional E-value: 0.88 DUF3399 43 psrspslssqegltss 58 + +slss+++ +s+ XP_026693459.1 674 SVPMTSLSSSDASSST 689 4466788888666554 PP
Or compare XP_026693459.1 to CDD or PaperBLAST