XP_030098415.1 has 1497 amino acids
Query: GLTSCR1 [M=102]
Accession: PF15249.10
Description: Conserved region of unknown function on GLTSCR protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-40 124.1 0.6 2.5e-40 123.4 0.6 1.3 1 XP_030098415.1
Domain annotation for each sequence (and alignments):
>> XP_030098415.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 123.4 0.6 2.5e-40 2.5e-40 2 101 .. 1021 1120 .. 1020 1121 .. 0.97
Alignments for each domain:
== domain 1 score: 123.4 bits; conditional E-value: 2.5e-40
GLTSCR1 2 qkavlnPdvktpFasleDAvkRLlPYHvfqepkedeedlekadeefekvatellkrfqkllnkyrrlllreskrespseeevmlerllleeer 94
q +vl+Pd+kt F s+eDA++RLlPYHv+q++ ++++d++k+deefe+v+t+llkr+q++lnkyr lll+es+r sps+e+vm++r++++ee+
XP_030098415.1 1021 QGSVLHPDYKTAFPSFEDALHRLLPYHVYQGALPSPNDYHKVDEEFETVSTQLLKRTQAMLNKYRLLLLEESRRVSPSAEMVMIDRMFIQEEK 1113
789****************************************************************************************** PP
GLTSCR1 95 aeleelk 101
++l+ +k
XP_030098415.1 1114 TTLALDK 1120
**99876 PP
Or compare XP_030098415.1 to CDD or PaperBLAST