XP_030098915.1 has 175 amino acids
Query: GARIL_Rab2_bd [M=71]
Accession: PF12480.12
Description: Golgi associated RAB2 interactor protein-like, Rab2B-binding domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.1e-20 59.9 0.1 1.8e-20 59.2 0.1 1.3 1 XP_030098915.1
Domain annotation for each sequence (and alignments):
>> XP_030098915.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 59.2 0.1 1.8e-20 1.8e-20 7 66 .. 2 61 .. 1 63 [. 0.95
Alignments for each domain:
== domain 1 score: 59.2 bits; conditional E-value: 1.8e-20
GARIL_Rab2_bd 7 llPlkfvklsvydkekqllklklvtgRsfyleLtksadepeslfqmwlrlvhlLrsplst 66
l+Pl+fv+l v+d++ q+lk+k+ tgR+fyl+L +++++++ f +w+rl++ Lr + +t
XP_030098915.1 2 LFPLQFVQLFVHDESRQQLKVKFRTGRAFYLQLRSPPETRDCEFGRWVRLLYRLRFHSPT 61
68**************************************************99988776 PP
Or compare XP_030098915.1 to CDD or PaperBLAST