XP_031403475.1 has 357 amino acids
Query: DUF761 [M=36]
Accession: PF05553.15
Description: Cotton fibre expressed protein
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-20 58.4 8.8 2.1e-20 58.4 8.8 1.7 2 XP_031403475.1
Domain annotation for each sequence (and alignments):
>> XP_031403475.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -2.0 0.2 0.16 0.16 4 10 .. 194 200 .. 193 200 .. 0.88
2 ! 58.4 8.8 2.1e-20 2.1e-20 1 36 [] 319 354 .. 319 354 .. 0.98
Alignments for each domain:
== domain 1 score: -2.0 bits; conditional E-value: 0.16
DUF761 4 vDakAEa 10
+++kAE+
XP_031403475.1 194 LNEKAEE 200
79****7 PP
== domain 2 score: 58.4 bits; conditional E-value: 2.1e-20
DUF761 1 deevDakAEaFIakFreqlrLQRqeSikryqemlaR 36
++e+++++EaFI+kF+e++rLQRqeS+++yqem++R
XP_031403475.1 319 QDELNRRVEAFIKKFNEEMRLQRQESLNQYQEMIRR 354
79********************************98 PP
Or compare XP_031403475.1 to CDD or PaperBLAST