PaperBLAST – Find papers about a protein or its homologs

 

Align XP_036019406.1 to PF10224 (DUF2205)

XP_036019406.1 has 162 amino acids

Query:       DUF2205  [M=75]
Accession:   PF10224.14
Description: Short coiled-coil protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.2e-30   89.7   3.9      9e-30   89.0   3.9    1.4  1  XP_036019406.1  


Domain annotation for each sequence (and alignments):
>> XP_036019406.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.0   3.9     9e-30     9e-30       9      72 ..      91     154 ..      82     157 .. 0.90

  Alignments for each domain:
  == domain 1  score: 89.0 bits;  conditional E-value: 9e-30
         DUF2205   9 dleklekeareeLqeqakeLqssLqalaervdaVkeehdKLesenkfLqkYIgdLmstskitss 72 
                       +++e e++++L++q+ eLq++L++l++rvdaVkee++KL+sen++L++YI++Lms+s+++++
  XP_036019406.1  91 AENQVELEEKTQLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSVFQT 154
                     3468999*******************************************************98 PP



Or compare XP_036019406.1 to CDD or PaperBLAST