XP_038943469.1 has 5201 amino acids
Query: ZnF_RZ-type [M=54] Accession: PF20173.3 Description: RZ type zinc finger domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-23 67.8 1.2 2.6e-23 67.8 1.2 2.4 2 XP_038943469.1 Domain annotation for each sequence (and alignments): >> XP_038943469.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -2.2 0.1 0.18 0.18 37 50 .. 2517 2530 .. 2505 2533 .. 0.76 2 ! 67.8 1.2 2.6e-23 2.6e-23 8 51 .. 4498 4541 .. 4490 4544 .. 0.91 Alignments for each domain: == domain 1 score: -2.2 bits; conditional E-value: 0.18 ZnF_RZ-type 37 CgatIGGeshnlaa 50 C +t+GGe+ n + XP_038943469.1 2517 CDRTVGGEHLNEDS 2530 *******9877655 PP == domain 2 score: 67.8 bits; conditional E-value: 2.6e-23 ZnF_RZ-type 8 tghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaag 51 + +wY+CpnGHp+ +geCG++me+s Cp+C+ +IGG +h++ g XP_038943469.1 4498 NVRWYTCPNGHPCSVGECGQPMEMSICPDCRVPIGGLNHKPSVG 4541 689*************************************9876 PP
Or compare XP_038943469.1 to CDD or PaperBLAST