XP_042106507.1 has 103 amino acids
Query: DUF4535 [M=45]
Accession: PF15054.10
Description: Domain of unknown function (DUF4535)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.4e-15 40.7 0.1 1.6e-14 39.6 0.1 1.6 1 XP_042106507.1
Domain annotation for each sequence (and alignments):
>> XP_042106507.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 39.6 0.1 1.6e-14 1.6e-14 3 36 .. 66 99 .. 64 100 .. 0.90
Alignments for each domain:
== domain 1 score: 39.6 bits; conditional E-value: 1.6e-14
DUF4535 3 fsFglGtycGiYvAQNYeVPnvkklantglekak 36
+ F +Gt +GiYvAQ Y VPnv+k+ ++ l++++
XP_042106507.1 66 LGFAVGTCTGIYVAQAYAVPNVEKTLRDYLQSLR 99
569**********************999998765 PP
Or compare XP_042106507.1 to CDD or PaperBLAST