PaperBLAST – Find papers about a protein or its homologs

 

Align XP_059604202.1 to PF16297 (DUF4939)

XP_059604202.1 has 496 amino acids

Query:       DUF4939  [M=112]
Accession:   PF16297.9
Description: Domain of unknown function (DUF4939)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.9e-12   31.8   0.1    2.6e-11   29.7   0.1    2.0  2  XP_059604202.1  


Domain annotation for each sequence (and alignments):
>> XP_059604202.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.3   0.0      0.11      0.11      16      36 ..      67      87 ..      58      90 .. 0.74
   2 !   29.7   0.1   2.6e-11   2.6e-11      27     104 ..     183     260 ..     172     266 .. 0.91

  Alignments for each domain:
  == domain 1  score: -1.3 bits;  conditional E-value: 0.11
         DUF4939 16 lrkrrwrnpipfpelfdGese 36
                     r++  +  ip+p + + e  
  XP_059604202.1 67 HRMSDRKDEIPYPRRVEAELA 87
                    456667788*****9998865 PP

  == domain 2  score: 29.7 bits;  conditional E-value: 2.6e-11
         DUF4939  27 fpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefG 104
                      p lf G+ ++l + i   +   l d+   ++d++k a+l t+l+G al+w  +    d  + ++y+ f+++++  f 
  XP_059604202.1 183 KPVLFYGKDNQLEDVITYCTLRFLTDDAFDDNDKRKSAYLGTLLRGPALRWLSKEQSVDPEIYDDYQEFVKKVRTAFA 260
                     58899*********99999988999999999******************************************99997 PP



Or compare XP_059604202.1 to CDD or PaperBLAST