XP_059604202.1 has 496 amino acids
Query: DUF4939 [M=112] Accession: PF16297.9 Description: Domain of unknown function (DUF4939) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-12 31.8 0.1 2.6e-11 29.7 0.1 2.0 2 XP_059604202.1 Domain annotation for each sequence (and alignments): >> XP_059604202.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.11 0.11 16 36 .. 67 87 .. 58 90 .. 0.74 2 ! 29.7 0.1 2.6e-11 2.6e-11 27 104 .. 183 260 .. 172 266 .. 0.91 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.11 DUF4939 16 lrkrrwrnpipfpelfdGese 36 r++ + ip+p + + e XP_059604202.1 67 HRMSDRKDEIPYPRRVEAELA 87 456667788*****9998865 PP == domain 2 score: 29.7 bits; conditional E-value: 2.6e-11 DUF4939 27 fpelfdGeserlpefivqtlsymlvdektfssdalkvaflitrlkGralewvmpyiqkdspllnnyraflnemkeefG 104 p lf G+ ++l + i + l d+ ++d++k a+l t+l+G al+w + d + ++y+ f+++++ f XP_059604202.1 183 KPVLFYGKDNQLEDVITYCTLRFLTDDAFDDNDKRKSAYLGTLLRGPALRWLSKEQSVDPEIYDDYQEFVKKVRTAFA 260 58899*********99999988999999999******************************************99997 PP
Or compare XP_059604202.1 to CDD or PaperBLAST