XP_063129573.1 has 72 amino acids
Query: DUF4538 [M=57]
Accession: PF15061.10
Description: Domain of unknown function (DUF4538)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
3.1e-30 90.1 0.1 3.8e-30 89.7 0.1 1.1 1 XP_063129573.1
Domain annotation for each sequence (and alignments):
>> XP_063129573.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 89.7 0.1 3.8e-30 3.8e-30 1 55 [. 4 58 .. 4 60 .. 0.98
Alignments for each domain:
== domain 1 score: 89.7 bits; conditional E-value: 3.8e-30
DUF4538 1 lrglkyallvgGfVgliglAlYPIiiaPmlhpeeYkkiQkinragikqeeiqPgg 55
+r+l++al++gGf++++g+A+YPI+++P+l+ eeY+k+Q++nragi qe++qP+g
XP_063129573.1 4 ARNLRTALIFGGFISMVGAAFYPIYFRPLLRLEEYQKEQAVNRAGIVQEDVQPPG 58
69***************************************************97 PP
Or compare XP_063129573.1 to CDD or PaperBLAST