PaperBLAST – Find papers about a protein or its homologs

 

Align XP_643621.1 to PF10998 (DUF2838)

XP_643621.1 has 477 amino acids

Query:       DUF2838  [M=111]
Accession:   PF10998.12
Description: Protein of unknown function (DUF2838)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    7.4e-43  131.6   9.0    7.4e-43  131.6   9.0    2.4  2  XP_643621.1  


Domain annotation for each sequence (and alignments):
>> XP_643621.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  131.6   9.0   7.4e-43   7.4e-43       1     111 []     103     213 ..     103     213 .. 0.99
   2 ?   -3.9   6.4      0.92      0.92      41      83 ..     302     351 ..     298     372 .. 0.51

  Alignments for each domain:
  == domain 1  score: 131.6 bits;  conditional E-value: 7.4e-43
      DUF2838   1 dklsFvlgvlnvlltalllgkapellplvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGplalAiitwr 98 
                  dk+sFvlgvln++++++++gk+p +l+++++ ++lvl+++r++ y++kklhYfl+D+CYf+nl+ll++++ lp++++ f+++f++anGpl+ A+i +r
  XP_643621.1 103 DKFSFVLGVLNLCVISFICGKYPLYLQYFFSGEYLVLFATRIILYKRKKLHYFLFDFCYFANLMLLFFIYGLPDRQWYFITCFCIANGPLLGAVIPYR 200
                  8************************************************************************************************* PP

      DUF2838  99 nslvfhsldkvtS 111
                  ns+vfhsldk tS
  XP_643621.1 201 NSMVFHSLDKATS 213
                  ***********98 PP

  == domain 2  score: -3.9 bits;  conditional E-value: 0.92
      DUF2838  41 ryvtyrkkklhYfllDlCYfvn.llllllllvl......peskelfkavf 83 
                  ry+++ k + ++f++ +  f+  ll++l ++++       +   +f+++ 
  XP_643621.1 302 RYLNFAKPNHRLFFFIFSQFTYtLLTILPCWLYykyqviHSLYLIFVVTV 351
                  66666666666655555544432445555555522222111222333333 PP



Or compare XP_643621.1 to CDD or PaperBLAST