XP_643621.1 has 477 amino acids
Query: DUF2838 [M=111] Accession: PF10998.12 Description: Protein of unknown function (DUF2838) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-43 131.6 9.0 7.4e-43 131.6 9.0 2.4 2 XP_643621.1 Domain annotation for each sequence (and alignments): >> XP_643621.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 131.6 9.0 7.4e-43 7.4e-43 1 111 [] 103 213 .. 103 213 .. 0.99 2 ? -3.9 6.4 0.92 0.92 41 83 .. 302 351 .. 298 372 .. 0.51 Alignments for each domain: == domain 1 score: 131.6 bits; conditional E-value: 7.4e-43 DUF2838 1 dklsFvlgvlnvlltalllgkapellplvytvlllvllplryvtyrkkklhYfllDlCYfvnllllllllvlpeskelfkavfvlanGplalAiitwr 98 dk+sFvlgvln++++++++gk+p +l+++++ ++lvl+++r++ y++kklhYfl+D+CYf+nl+ll++++ lp++++ f+++f++anGpl+ A+i +r XP_643621.1 103 DKFSFVLGVLNLCVISFICGKYPLYLQYFFSGEYLVLFATRIILYKRKKLHYFLFDFCYFANLMLLFFIYGLPDRQWYFITCFCIANGPLLGAVIPYR 200 8************************************************************************************************* PP DUF2838 99 nslvfhsldkvtS 111 ns+vfhsldk tS XP_643621.1 201 NSMVFHSLDKATS 213 ***********98 PP == domain 2 score: -3.9 bits; conditional E-value: 0.92 DUF2838 41 ryvtyrkkklhYfllDlCYfvn.llllllllvl......peskelfkavf 83 ry+++ k + ++f++ + f+ ll++l ++++ + +f+++ XP_643621.1 302 RYLNFAKPNHRLFFFIFSQFTYtLLTILPCWLYykyqviHSLYLIFVVTV 351 66666666666655555544432445555555522222111222333333 PP
Or compare XP_643621.1 to CDD or PaperBLAST