XP_649190.1 has 399 amino acids
Query: DUF676 [M=217] Accession: PF05057.18 Description: Putative serine esterase (DUF676) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-10 27.3 0.1 2.6e-10 26.2 0.0 1.6 2 XP_649190.1 Domain annotation for each sequence (and alignments): >> XP_649190.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 26.2 0.0 2.6e-10 2.6e-10 69 148 .. 168 240 .. 160 300 .. 0.74 2 ? -3.5 0.0 0.34 0.34 40 71 .. 363 394 .. 349 396 .. 0.58 Alignments for each domain: == domain 1 score: 26.2 bits; conditional E-value: 2.6e-10 DUF676 69 vvkkkkdkikkiSfvghSlGgliaryaigklkekkmtlkglikglepvtFitlasPhLGvlgekplinlglalleklkks 148 ++k+++++ +k+ +v hS+Ggl+ + + kl + +++ +++ ++++++P++G+ + +++ g ++ ++k XP_649190.1 168 IIKAYENTGNKVVLVSHSMGGLTTYILLDKLG-------KEFCDKYIHRWVAMSTPFIGTTIANDVVLAGYNMGYPVSKE 240 46677777779************999999888.......357888*******************9987776654444443 PP == domain 2 score: -3.5 bits; conditional E-value: 0.34 DUF676 40 vvlmsennesktfkgidvlgerlaeevlevvk 71 +++ ++ ++ + + g l +ev+e+vk XP_649190.1 363 EYCKKMTENFTNLGKYTHQGMLLKKEVIEYVK 394 45555544444444455556666677777766 PP
Or compare XP_649190.1 to CDD or PaperBLAST