XP_749648.1 has 1914 amino acids
Query: ZnF_RZ-type [M=54]
Accession: PF20173.2
Description: RZ type zinc finger domain
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.8e-27 81.0 6.2 1.8e-27 81.0 6.2 3.5 2 XP_749648.1
Domain annotation for each sequence (and alignments):
>> XP_749648.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ? -13.3 13.0 1 1 16 28 .. 1402 1414 .. 1391 1428 .. 0.58
2 ! 81.0 6.2 1.8e-27 1.8e-27 1 54 [] 1848 1901 .. 1848 1901 .. 0.97
Alignments for each domain:
== domain 1 score: -13.3 bits; conditional E-value: 1
ZnF_RZ-type 16 nGHpYvigeCGra 28
+GH + + CG++
XP_749648.1 1402 CGHSKCTKKCGEP 1414
4444444444444 PP
== domain 2 score: 81.0 bits; conditional E-value: 1.8e-27
ZnF_RZ-type 1 lakafkgtghwYkCpnGHpYvigeCGrameesrCpeCgatIGGeshnlaagntr 54
+a++f+gtghwY+C+nGHp++igeCG+ame+ CpeCg+++GG+ h++a+g+tr
XP_749648.1 1848 MAREFHGTGHWYYCRNGHPFTIGECGGAMEQTACPECGEPVGGRAHRVAEGVTR 1901
789************************************************986 PP
Or compare XP_749648.1 to CDD or PaperBLAST