XP_754780.1 has 331 amino acids
Query: DUF1746 [M=116] Accession: PF08508.14 Description: Fungal domain of unknown function (DUF1746) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-48 150.1 3.3 2.2e-48 149.6 3.3 1.2 1 XP_754780.1 Domain annotation for each sequence (and alignments): >> XP_754780.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 149.6 3.3 2.2e-48 2.2e-48 1 116 [] 60 173 .. 60 173 .. 0.97 Alignments for each domain: == domain 1 score: 149.6 bits; conditional E-value: 2.2e-48 DUF1746 1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesftellpaekpllvaillsnllclllhllfslpsageatrgylhggliidFiGqkapts 98 +Ld+l+y++l++lYymDcs++++++Raivql+f+tpk+++f ++++p+++ai++sn++c+++h +f+ p+a+eatrgylhggl+idFiGqkap+s XP_754780.1 60 DLDILIYCELSALYYMDCSVILFAIRAIVQLIFFTPKAPPFDP--TRNQPFIGAIFVSNIFCMIFHNFFTHPEASEATRGYLHGGLLIDFIGQKAPIS 155 69*************************************8755..489************************************************** PP DUF1746 99 rlellllDllilllqllm 116 ++l+llD+l+l+l+l+m XP_754780.1 156 LFRLFLLDFLVLILDLVM 173 *****************9 PP
Or compare XP_754780.1 to CDD or PaperBLAST