PaperBLAST – Find papers about a protein or its homologs

 

Align XP_754780.1 to PF08508 (DUF1746)

XP_754780.1 has 331 amino acids

Query:       DUF1746  [M=116]
Accession:   PF08508.15
Description: Fungal domain of unknown function (DUF1746)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.4e-48  148.2   3.2    9.2e-48  147.7   3.2    1.2  1  XP_754780.1  


Domain annotation for each sequence (and alignments):
>> XP_754780.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  147.7   3.2   9.2e-48   9.2e-48       1     116 []      60     173 ..      60     173 .. 0.97

  Alignments for each domain:
  == domain 1  score: 147.7 bits;  conditional E-value: 9.2e-48
      DUF1746   1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesfaellpaekpllvailvsnllclllhllfslpsageatrgylhggliidFiGqkapts 98 
                  +Ld+l+y++l++lYymDcs++++++Raivql+f+tpk++ f  +  +++p+++ai+vsn++c+++h +f  p+a+eatrgylhggl+idFiGqkap+s
  XP_754780.1  60 DLDILIYCELSALYYMDCSVILFAIRAIVQLIFFTPKAPPFDPT--RNQPFIGAIFVSNIFCMIFHNFFTHPEASEATRGYLHGGLLIDFIGQKAPIS 155
                  69*************************************87554..89************************************************** PP

      DUF1746  99 rlellllDllilllqlvm 116
                   ++l llD+l+l+l+lvm
  XP_754780.1 156 LFRLFLLDFLVLILDLVM 173
                  *****************9 PP



Or compare XP_754780.1 to CDD or PaperBLAST