XP_754780.1 has 331 amino acids
Query: DUF1746 [M=116] Accession: PF08508.15 Description: Fungal domain of unknown function (DUF1746) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.4e-48 148.2 3.2 9.2e-48 147.7 3.2 1.2 1 XP_754780.1 Domain annotation for each sequence (and alignments): >> XP_754780.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 147.7 3.2 9.2e-48 9.2e-48 1 116 [] 60 173 .. 60 173 .. 0.97 Alignments for each domain: == domain 1 score: 147.7 bits; conditional E-value: 9.2e-48 DUF1746 1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesfaellpaekpllvailvsnllclllhllfslpsageatrgylhggliidFiGqkapts 98 +Ld+l+y++l++lYymDcs++++++Raivql+f+tpk++ f + +++p+++ai+vsn++c+++h +f p+a+eatrgylhggl+idFiGqkap+s XP_754780.1 60 DLDILIYCELSALYYMDCSVILFAIRAIVQLIFFTPKAPPFDPT--RNQPFIGAIFVSNIFCMIFHNFFTHPEASEATRGYLHGGLLIDFIGQKAPIS 155 69*************************************87554..89************************************************** PP DUF1746 99 rlellllDllilllqlvm 116 ++l llD+l+l+l+lvm XP_754780.1 156 LFRLFLLDFLVLILDLVM 173 *****************9 PP
Or compare XP_754780.1 to CDD or PaperBLAST