XP_846013.1 has 180 amino acids
Query: DUF202 [M=68] Accession: PF02656.19 Description: Domain of unknown function (DUF202) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-20 60.0 0.1 3.5e-19 55.4 0.0 2.1 2 XP_846013.1 Domain annotation for each sequence (and alignments): >> XP_846013.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 55.4 0.0 3.5e-19 3.5e-19 1 66 [. 62 125 .. 62 127 .. 0.89 2 ! 2.7 0.0 0.0096 0.0096 35 64 .. 141 167 .. 134 171 .. 0.54 Alignments for each domain: == domain 1 score: 55.4 bits; conditional E-value: 3.5e-19 DUF202 1 rdglAnERTfLaWlRtslalialgvallrffleggptalalilglilivlgiltlllalvrylrre 66 ++++AnERTfL+W+ +s+++++++++ll+f + + ++ ++gl+l+ ++il+++ +l+ + r+ XP_846013.1 62 KTFFANERTFLKWMSISVMIGMMSLTLLNF--GDTSSNASELAGLVLLPVSILFMIHSLFVFKDRA 125 799**************************9..44455556******************99988776 PP == domain 2 score: 2.7 bits; conditional E-value: 0.0096 DUF202 35 gptalalilglilivlgiltlllalvrylr 64 gpt l l+lg+ l +++i+ +y+r XP_846013.1 141 GPTILVLVLGVSLGIAAIFS---VQKQYYR 167 45555555555555555554...4444444 PP
Or compare XP_846013.1 to CDD or PaperBLAST