XP_965449.2 has 373 amino acids
Query: DUF1746 [M=116] Accession: PF08508.15 Description: Fungal domain of unknown function (DUF1746) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.1e-48 148.5 0.2 7.4e-48 148.0 0.2 1.2 1 XP_965449.2 Domain annotation for each sequence (and alignments): >> XP_965449.2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 148.0 0.2 7.4e-48 7.4e-48 1 116 [] 90 203 .. 90 203 .. 0.98 Alignments for each domain: == domain 1 score: 148.0 bits; conditional E-value: 7.4e-48 DUF1746 1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesfaellpaekpllvailvsnllclllhllfslpsageatrgylhggliidFiGqkapts 98 +Ld++ +++l++lYym+cs+lrl++R+i +++f+tpk+ + llpae+p+++ail++nl+c+l+h+++++p ageatrgylhgg+i+dF+Gqk+pt+ XP_965449.2 90 NLDMIYFAYLCTLYYMECSFLRLFVRIIPHFMFITPKEG--PVLLPAERPHVFAILGPNLICILAHIISAPPVAGEATRGYLHGGVIVDFVGQKPPTT 185 79*************************************..56889**************************************************** PP DUF1746 99 rlellllDllilllqlvm 116 rl l++D +il++q++m XP_965449.2 186 RLGPLFFDAVILAIQCLM 203 *****************9 PP
Or compare XP_965449.2 to CDD or PaperBLAST