PaperBLAST – Find papers about a protein or its homologs

 

Align XP_965449.2 to PF08508 (DUF1746)

XP_965449.2 has 373 amino acids

Query:       DUF1746  [M=116]
Accession:   PF08508.15
Description: Fungal domain of unknown function (DUF1746)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.1e-48  148.5   0.2    7.4e-48  148.0   0.2    1.2  1  XP_965449.2  


Domain annotation for each sequence (and alignments):
>> XP_965449.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  148.0   0.2   7.4e-48   7.4e-48       1     116 []      90     203 ..      90     203 .. 0.98

  Alignments for each domain:
  == domain 1  score: 148.0 bits;  conditional E-value: 7.4e-48
      DUF1746   1 sLdllvyvllvilYymDcsllrlllRaivqlsfltpkpesfaellpaekpllvailvsnllclllhllfslpsageatrgylhggliidFiGqkapts 98 
                  +Ld++ +++l++lYym+cs+lrl++R+i +++f+tpk+   + llpae+p+++ail++nl+c+l+h+++++p ageatrgylhgg+i+dF+Gqk+pt+
  XP_965449.2  90 NLDMIYFAYLCTLYYMECSFLRLFVRIIPHFMFITPKEG--PVLLPAERPHVFAILGPNLICILAHIISAPPVAGEATRGYLHGGVIVDFVGQKPPTT 185
                  79*************************************..56889**************************************************** PP

      DUF1746  99 rlellllDllilllqlvm 116
                  rl  l++D +il++q++m
  XP_965449.2 186 RLGPLFFDAVILAIQCLM 203
                  *****************9 PP



Or compare XP_965449.2 to CDD or PaperBLAST