biolip::1ecmB has 95 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
6.6e-24 70.5 2.0 7.7e-24 70.3 2.0 1.1 1 biolip::1ecmB
Domain annotation for each sequence (and alignments):
>> biolip::1ecmB
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 70.3 2.0 7.7e-24 7.7e-24 1 79 [] 6 84 .. 6 84 .. 0.98
Alignments for each domain:
== domain 1 score: 70.3 bits; conditional E-value: 7.7e-24
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQk 79
R++I ++D++ll+LlaeR ela e++++K ++ pv+d +Re+++lerl ++++ld+++++++f+ ii+ s+ Q+
biolip::1ecmB 6 REKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLGKAHHLDAHYITRLFQLIIEDSVLTQQ 84
99****************************9999*****************9999*******************99986 PP
Or compare biolip::1ecmB to CDD or PaperBLAST