biolip::2ao2A has 165 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
1.6e-17 50.0 0.2 7e-17 48.0 0.1 2.0 2 biolip::2ao2A
Domain annotation for each sequence (and alignments):
>> biolip::2ao2A
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 48.0 0.1 7e-17 7e-17 10 78 .. 7 75 .. 6 76 .. 0.96
2 ? -0.7 0.0 0.11 0.11 1 13 [. 100 112 .. 100 115 .. 0.84
Alignments for each domain:
== domain 1 score: 48.0 bits; conditional E-value: 7e-17
CM_2 10 elleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
el++ aeR+e+a+ +a++K +++lp+ d R+e++l++l e+a+++++dp++v+++f++ i+++ a++
biolip::2ao2A 7 ELVDAAAERLEVADPVAAFKWRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIE 75
89******************99999*************************************9998887 PP
== domain 2 score: -0.7 bits; conditional E-value: 0.11
CM_2 1 RkeIdeiDrelle 13
R+ Id++++++l
biolip::2ao2A 100 RSAIDSLNNRMLS 112
8899999999985 PP
Or compare biolip::2ao2A to CDD or PaperBLAST