biolip::2h9dD has 100 amino acids
Query: CM_2 [M=79]
Accession: PF01817.25
Description: Chorismate mutase type II
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
2.1e-22 65.6 0.1 2.4e-22 65.4 0.1 1.0 1 biolip::2h9dD
Domain annotation for each sequence (and alignments):
>> biolip::2h9dD
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 65.4 0.1 2.4e-22 2.4e-22 1 78 [. 14 90 .. 14 91 .. 0.96
Alignments for each domain:
== domain 1 score: 65.4 bits; conditional E-value: 2.4e-22
CM_2 1 RkeIdeiDrelleLlaeRmelakeiaeyKkenglpvldpeReeevlerlregaeelgldpeavekifreiisesralQ 78
R+ Id+iD ++++ l +Rm+++k++ ++K+ ++ ++ peR++++l +++++aee+gld+ +ve +f +ii++ +a Q
biolip::2h9dD 14 REAIDRIDLDIVQALGRRMDYVKAASRFKA-SEAAIPAPERVAAMLPERARWAEENGLDAPFVEGLFAQIIHWYIAEQ 90
99***************************6.6669****************************************998 PP
Or compare biolip::2h9dD to CDD or PaperBLAST