biolip::2i76A has 247 amino acids
Query: DUF2520 [M=125]
Accession: PF10728.13
Description: Domain of unknown function (DUF2520)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.7e-36 108.9 0.0 1.4e-35 108.0 0.0 1.4 1 biolip::2i76A
Domain annotation for each sequence (and alignments):
>> biolip::2i76A
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 108.0 0.0 1.4e-35 1.4e-35 1 110 [. 112 221 .. 112 240 .. 0.94
Alignments for each domain:
== domain 1 score: 108.0 bits; conditional E-value: 1.4e-35
DUF2520 1 ipfaiegdeealevleelaeslggkvveidseqrklyHaAavfasNflvtllalaeelleeagleeafeallpLiretlenilelgpkealTGPva 96
i+f++egde+ l++++++ae+++gk+++i+se++k+yH+Aav+asNf v+l++l+++++ gl+e++ +++ L+++ ++ni++++++ +lTGPv+
biolip::2i76A 112 IVFGLEGDERGLPIVKKIAEEISGKYFVIPSEKKKAYHLAAVIASNFPVALAYLSKRIYTLLGLDEPELLIHTLMKGVADNIKKMRVECSLTGPVK 207
689********************************************************************************************* PP
DUF2520 97 RgDaetvekhleal 110
RgD+++ve++ ++
biolip::2i76A 208 RGDWQVVEEERREY 221
********988755 PP
Or compare biolip::2i76A to CDD or PaperBLAST