PaperBLAST – Find papers about a protein or its homologs

 

Align biolip::2iwvA to PF04338 (DUF481)

biolip::2iwvA has 277 amino acids

Query:       DUF481  [M=210]
Accession:   PF04338.16
Description: Protein of unknown function, DUF481
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence      Description
    ------- ------ -----    ------- ------ -----   ---- --  --------      -----------
    2.9e-12   33.1   1.1    2.9e-12   33.1   1.1    1.9  2  biolip::2iwvA  


Domain annotation for each sequence (and alignments):
>> biolip::2iwvA  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.1   1.1   2.9e-12   2.9e-12      93     196 ..      71     181 ..      70     188 .. 0.85
   2 ?   -1.0   0.1     0.078     0.078     103     135 ..     244     275 ..     231     277 .] 0.57

  Alignments for each domain:
  == domain 1  score: 33.1 bits;  conditional E-value: 2.9e-12
         DUF481  93 GyqlidtdktklsleaGpgyryekftdgpedeeeviarasl..dyeykisdnlkftqelealv.....nleggsnttlrsetgltakltdalalki 181
                     yq++++d++++ l +G     +++ d+p +++  + r+++  d++ k++d+l+f+ +l++++     n +g ++t++++etgl++ +++ +al++
  biolip::2iwvA  71 HYQFLENDDFSFGLTGGFRNYGYHYVDEPGKDTANMQRWKIapDWDVKLTDDLRFNGWLSMYKfandlNTTGYADTRVETETGLQYTFNETVALRV 166
                    59*****************99999****99999999999883345779*************8633333667889999******************* PP

         DUF481 182 syevdydskppegkk 196
                    +y ++   +++++++
  biolip::2iwvA 167 NYYLERGFNMDDSRN 181
                    **9988777777655 PP

  == domain 2  score: -1.0 bits;  conditional E-value: 0.078
         DUF481 103 klsleaGpgyryekftdgpedeeeviarasldy 135
                     ls+ + +++++++ ++g +++++  a ++++y
  biolip::2iwvA 244 GLSVSLEYAFEWQDHDEG-DSDKFHYAGVGVNY 275
                    355555555555555555.55555555555555 PP



Or compare biolip::2iwvA to CDD or PaperBLAST