biolip::2j8uE has 194 amino acids
Query: DUF1968 [M=81]
Accession: PF09291.14
Description: Domain of unknown function (DUF1968)
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.6e-42 127.6 1.1 1.4e-41 126.7 1.1 1.4 1 biolip::2j8uE
Domain annotation for each sequence (and alignments):
>> biolip::2j8uE
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 126.7 1.1 1.4e-41 1.4e-41 1 73 [. 121 193 .. 121 194 .] 0.99
Alignments for each domain:
== domain 1 score: 126.7 bits; conditional E-value: 1.4e-41
DUF1968 1 PavYqLkspkssdtsvCLfTDFdsqvnvsqskeseviktdktvldmksldsKSngavaWsnksdfkCqdtfke 73
PavYqLk+p+s+d+++CLfTDFdsq+nv +++es +++tdktvldmk++dsKSnga+aWsn+++f+Cqd+fke
biolip::2j8uE 121 PAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTVLDMKAMDSKSNGAIAWSNQTSFTCQDIFKE 193
9**********************************************************************98 PP
Or compare biolip::2j8uE to CDD or PaperBLAST