biolip::2r84B has 313 amino acids
Query: DUF1297 [M=188] Accession: PF06973.16 Description: Domain of unknown function (DUF1297) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.2e-79 249.5 0.1 1.3e-78 249.0 0.1 1.1 1 biolip::2r84B Domain annotation for each sequence (and alignments): >> biolip::2r84B # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 249.0 0.1 1.3e-78 1.3e-78 21 188 .] 147 313 .] 142 313 .] 0.98 Alignments for each domain: == domain 1 score: 249.0 bits; conditional E-value: 1.3e-78 DUF1297 21 keasieeyvvGanfnlnyFysplkeevellgidrRyesnldglvrlpakeqleleiepeyvvvGnipvvlREsllekvfelgekfveaakklvppG 116 e++i+eyv+G++++ +yFys+++ee+el++idrRyesn+d + r+pak+qle++++++y+v+Gnip+vlREsll +v+e+ge++v+aa++l+ G biolip::2r84B 147 AEIQIQEYVLGVPVYPHYFYSKVREELELMSIDRRYESNVDAIGRIPAKDQLEFDMDITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMG-G 241 5799**************************************************************************************9987.* PP DUF1297 117 iiGpFcLqsvvtedlelvvfevsaRivggtnvymegspyskllfgepmsmGrriarEikeaiekdrleevvt 188 ++GpFcL+ v+t+dle+vvfe+saRiv+gtn++++gspy++l +++p+s+Grria+Ei+eaie+d+le+v+t biolip::2r84B 242 LWGPFCLEGVFTPDLEFVVFEISARIVAGTNIFVNGSPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT 313 **********************************************************************98 PP
Or compare biolip::2r84B to CDD or PaperBLAST