biolip::3bk5A has 235 amino acids
Query: DUF1329 [M=368] Accession: PF07044.18 Description: Protein of unknown function (DUF1329) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-17 47.3 1.0 6.4e-10 24.8 0.9 2.1 2 biolip::3bk5A Domain annotation for each sequence (and alignments): >> biolip::3bk5A # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 21.3 0.0 7.8e-09 7.8e-09 147 214 .. 59 121 .. 44 131 .. 0.83 2 ! 24.8 0.9 6.4e-10 6.4e-10 258 342 .. 131 214 .. 118 233 .. 0.76 Alignments for each domain: == domain 1 score: 21.3 bits; conditional E-value: 7.8e-09 DUF1329 147 vtaParlaGeallvhetldqvkeprqawlYlpgqRRVRraPtlayDtpqaaadglrtlDdldmfnGap 214 + +P +++G+a+l+h+ ++ + wlYlp+ +RV+r+++ ++++++ ++dl+ f+ + biolip::3bk5A 59 FDQPRDVTGTAFLNHSHTIGAD---DQWLYLPALKRVKRISSRNKS--GPFMGSEFAYEDLSSFEIEK 121 689************9887777...89*************998765..68888889999988886444 PP == domain 2 score: 24.8 bits; conditional E-value: 6.4e-10 DUF1329 258 ryelhrVwvveAtlkegkrhiysKrvfYlDedswqilaadqYDarGeLwrvseahlinaydvpagwstlevlyDlqsgrytvdgl 342 ++ V+v+e + ++ + y K+v++lD +++l ++ YD++G L ++ ++++y + + ++++ + q+g+ t ++ biolip::3bk5A 131 KFNGQDVFVLEQIPTDK-NSGYTKQVVWLDKAHYRPLKVEFYDRKGALLKTLTFANYKQYLDKYWRAHTMAMTNHQTGKSTELNT 214 67778999**9888866.99******************************54444444444444445888999999998885554 PP
Or compare biolip::3bk5A to CDD or PaperBLAST