biolip::3cbtA has 210 amino acids
Query: DUF402 [M=68] Accession: PF04167.18 Description: Protein of unknown function (DUF402) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.4e-22 63.5 1.5 1.4e-21 62.7 1.5 1.4 1 biolip::3cbtA Domain annotation for each sequence (and alignments): >> biolip::3cbtA # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 62.7 1.5 1.4e-21 1.4e-21 3 68 .] 83 148 .. 81 148 .. 0.95 Alignments for each domain: == domain 1 score: 62.7 bits; conditional E-value: 1.4e-21 EEEEE-TT-SEEEEEEEETTTEEEEEEEEEES--EE..E.EEE-EEEEEEESEEE......-HHHH CS DUF402 3 alwllplgewynvtkfldedgrfkgwYvniatppergegtvkyiDldLDvvvypdgevevlDedEl 68 l l ++ge+++v+ f+d+ +rfk+wYvn+++p r eg v+ +D+ LD+ v+pd++++ DedE+ biolip::3cbtA 83 VLKLARPGEAWSVWLFWDPGWRFKNWYVNLERPLTRWEGGVDSEDHFLDISVHPDRTWHWRDEDEF 148 578999***************************9996688*************************9 PP
Or compare biolip::3cbtA to CDD or PaperBLAST